PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa05g018720.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family BBR-BPC
Protein Properties Length: 231aa    MW: 25078.7 Da    PI: 10.5899
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa05g018720.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind265.52.9e-812823094301
       GAGA_bind  94 alpvgvqvlsgtksidslqqlsepqledsavelreeeklealpie.eaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesaders 187
                     +  ++  ++++t+ id +q    +q ++    +  ++ +  +p++ + ++ + ++++k+++q+++k++++k+ +kk+  ++s+k++k+ s  +++
  Csa05g018720.1  28 HWFHSHIAVPKTTGIDLSQV---SQANPAEGVMVPQSRSFYPPTTiDYRNGVATVEQKSTNQSPSKALKPKTPRKKR--SASNKSKKTLSI-PET 116
                     33344677889999998777...333333333555555555554415566667777777788888777777766666..677777777776.799 PP

       GAGA_bind 188 kaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnp 282
                     k+ekk++d++++  s+D+s++P+PvCsCtG++r+CYkWG+GGWqS+CCt++iS+yPLP+st+r+gaR+agrKmS+ga+ klL++La+eGy+ls p
  Csa05g018720.1 117 KREKKNLDINIDISSFDTSGVPPPVCSCTGVSRVCYKWGMGGWQSSCCTISISTYPLPMSTTRPGARLAGRKMSNGAYVKLLARLAGEGYSLSYP 211
                     *********************************************************************************************** PP

       GAGA_bind 283 vDLkdhWAkHGtnkfvtir 301
                     vDLk+hWA+HGtnkfvti+
  Csa05g018720.1 212 VDLKNHWARHGTNKFVTIK 230
                     ******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012261.3E-991230IPR010409GAGA-binding transcriptional activator
PfamPF062171.9E-6973230IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MNSFPSQNLM LSATNANKDA ALLTSNAHWF HSHIAVPKTT GIDLSQVSQA NPAEGVMVPQ  60
SRSFYPPTTI DYRNGVATVE QKSTNQSPSK ALKPKTPRKK RSASNKSKKT LSIPETKREK  120
KNLDINIDIS SFDTSGVPPP VCSCTGVSRV CYKWGMGGWQ SSCCTISIST YPLPMSTTRP  180
GARLAGRKMS NGAYVKLLAR LAGEGYSLSY PVDLKNHWAR HGTNKFVTIK *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0899610.0EU089961.1 Arabidopsis arenosa GAGA-binding transcriptional activator (BBR/BPC7) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010509600.11e-172PREDICTED: protein BASIC PENTACYSTEINE7-like
RefseqXP_010509601.11e-172PREDICTED: protein BASIC PENTACYSTEINE7-like
SwissprotO822861e-142BPC7_ARATH; Protein BASIC PENTACYSTEINE7
TrEMBLR0HUS91e-147R0HUS9_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.4__1574__AT2G35550.41e-143(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM136742127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35550.41e-134basic pentacysteine 7